PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00016968-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family NF-YB
Protein Properties Length: 187aa    MW: 20916.4 Da    PI: 8.0386
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00016968-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB179.52.9e-5638134197
               NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                         ++eqdr+lPianv+rimkk+lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa+atlGf+dy+eplk yl++yr
  WALNUT_00016968-RA  38 MKEQDRLLPIANVGRIMKKILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWAMATLGFDDYAEPLKRYLQRYR 128
                         589**************************************************************************************** PP

               NF-YB  92 elegek 97 
                         elege+
  WALNUT_00016968-RA 129 ELEGER 134
                         ****97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.108.3E-5633153IPR009072Histone-fold
SuperFamilySSF471131.73E-4141151IPR009072Histone-fold
PfamPF008086.5E-2844108IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.5E-207290No hitNo description
PROSITE patternPS0068507591IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.5E-2091109No hitNo description
PRINTSPR006151.5E-20110128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MVDSTGGNNS DREGFKYHFA GTAPSVALGT DDDQDAAMKE QDRLLPIANV GRIMKKILPP  60
NAKISKEAKE TMQECVSEFI SFVTGEASDK CHKEKRKTVN GDDICWAMAT LGFDDYAEPL  120
KRYLQRYREL EGERSAQQSK PSSNEDQKNK TTNYGAAETT RKPTVPTTPS LKFNVIDRNN  180
SPVSRRF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-4638129192Transcription factor HapC (Eurofung)
4g92_B2e-4638129192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007201677.14e-85hypothetical protein PRUPE_ppa022586mg
SwissprotO822489e-63NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLM5VPK94e-85M5VPK9_PRUPE; Uncharacterized protein
STRINGPOPTR_0014s12710.13e-80(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.15e-64nuclear factor Y, subunit B5